PDB entry 3tzl

View 3tzl on RCSB PDB site
Description: Crystal Structure of Tryptophanyl-tRNA Synthetase from Campylobacter jejuni complexed with ADP and Tryptophane
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta structure, cytosol, LIGASE
Deposited on 2011-09-27, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0388, trpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tzla_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0388, trpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIB4 (3-321)
      • expression tag (2)
    Domains in SCOPe 2.07: d3tzlb1, d3tzlb2
  • Heterogens: ADP, TRP, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzlA (A:)
    snamrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqns
    lkaaaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsa
    shglfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvne
    evavvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiak
    lfldesgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildf
    gatkarkiaqekmqkiyekigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzlA (A:)
    mrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqnslka
    aaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsashg
    lfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvneeva
    vvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiaklfl
    desgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildfgat
    karkiaqekmqkiyekigl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tzlB (B:)
    snamrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqns
    lkaaaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsa
    shglfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvne
    evavvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiak
    lfldesgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildf
    gatkarkiaqekmqkiyekigl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzlB (B:)
    amrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqnslk
    aaaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsash
    glfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvneev
    avvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiaklf
    ldesgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildfga
    tkarkiaqekmqkiyekigl