PDB entry 3tzk

View 3tzk on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG)(G92A) from Vibrio cholerae
Class: oxidoreductase
Keywords: Vibrio cholerae, 3-ketoacyl-(acyl-carrier-protein) reductase, FabG, OXIDOREDUCTASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2011-09-27, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3tzka_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3tzkb_
  • Heterogens: SO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzkA (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnaaitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzkA (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnaaitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tzkB (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnaaitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzkB (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnaaitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi