PDB entry 3tzh

View 3tzh on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG)(F187A) from Vibrio cholerae
Class: oxidoreductase
Keywords: Vibrio cholerae, 3-ketoacyl-(acyl-carrier-protein) reductase, FabG, OXIDOREDUCTASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2011-09-27, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzha_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzhb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (3-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzhc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (3-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzhd_
  • Chain 'E':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzhe_
  • Chain 'F':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (Start-250)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d3tzhf_
  • Heterogens: UNX, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzhA (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhA (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tzhB (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhB (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tzhC (C:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhC (C:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tzhD (D:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhD (D:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tzhE (E:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhE (E:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tzhF (F:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzhF (F:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgaietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi