PDB entry 3tzf

View 3tzf on RCSB PDB site
Description: Crystal Structure of the Yersinia pestis Dihydropteroate Synthase with Sulfonamide Drug Complex.
Class: transferase/antibiotic/inhibitor
Keywords: Dihydropteroate synthase, sulfonamide complex, Tim barrel, TRANSFERASE-INHIBITOR-ANTIBIOTIC complex, TRANSFERASE-ANTIBIOTIC-INHIBITOR complex
Deposited on 2011-09-27, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tzfa_
  • Chain 'B':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tzfb_
  • Heterogens: HH2, MG, 08D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzfA (A:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzfA (A:)
    mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
    strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
    qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
    kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
    acaviaamqgaqiirvhdvketveamciveatrsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tzfB (B:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzfB (B:)
    mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
    strpgevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqe
    pgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiaknkl
    lldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsvac
    aviaamqgaqiirvhdvketveamciveatrsak