PDB entry 3tzd

View 3tzd on RCSB PDB site
Description: Crystal structure of the complex of Human Chromobox Homolog 3 (CBX3)
Class: TRANSCRIPTION/DNA binding Protein
Keywords: STRUCTURAL GENOMICS CONSORTIUM, SGC, CHROMATIN REGULATOR, NUCLEUS, PHOSPHOPROTEIN, REPRESSOR, TRANSCRIPTION REGULATION, TRANSCRIPTION-DNA binding Protein complex
Deposited on 2011-09-27, released 2012-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13185 (5-57)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d3tzda1, d3tzda2
  • Chain 'T':
    Compound: Histone H1.4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H1E, H1F4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10412 (1-End)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tzdA (A:)
    lyfqgefvvekvldrrvvngkveyflkwkgftdadntwepeenldcpelieaflnsqk
    

  • Chain 'T':
    No sequence available.