PDB entry 3tzc

View 3tzc on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG)(Y155F) from Vibrio cholerae
Class: oxidoreductase
Keywords: Vibrio cholerae, 3-ketoacyl-(acyl-carrier-protein) reductase, FabG, OXIDOREDUCTASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2011-09-27, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tzca_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04
      • engineered mutation (157)
    Domains in SCOPe 2.06: d3tzcb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tzcc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Vibrio cholerae [TaxId:593588]
    Gene: VC2021, VCD_002346
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NP04 (3-End)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d3tzcd_
  • Heterogens: NAP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tzcA (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanfaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzcA (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrmrmkeeewsdimetnltsifrlskav
    lrgmmkkrqgriinvgsvvaakagvigftksmarevasrgvtvntvapgfietdmdeqrt
    atlaqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tzcB (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanfaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzcB (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnawsdimetnltsifrlskavlrgmmkkrqgr
    iinvgsvvganfaaakagvigftksmarevasrgvtvntvapgfietdmteqrtatlaqv
    pagrlgdpreiasavaflaspeaayitgetlhvnggmy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tzcC (C:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanfaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzcC (C:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvakagvigftksmarevasrgvtvntvapgfietdmeqrtat
    laqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tzcD (D:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanfaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tzcD (D:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnaewsdimetnltsifrlskavlrgmmkkrq
    griinvgsvvanfaaakagvigftksmarevasrgvtvntvapgfietdmtkndeqrtat
    laqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy