PDB entry 3tz9

View 3tz9 on RCSB PDB site
Description: Kinase domain of cSrc in complex with RL130
Class: transferase/transferase inhibitor
Keywords: Type II, Allosteric, DFG-out, Drug resistance mutations, Tyrosin-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-27, released 2012-10-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.216
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC, v-Src sarcoma viral oncogene
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered mutation (97)
    Domains in SCOPe 2.05: d3tz9a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC, v-Src sarcoma viral oncogene
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered mutation (97)
    Domains in SCOPe 2.05: d3tz9b_
  • Heterogens: AQU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tz9A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tz9A (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadfglfpikwtapeaalygrftiksdvwsfgill
    telttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeyl
    qafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tz9B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tz9B (B:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadffpikwtapeaalygrftiksdvwsfgillte
    lttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqa
    fledyftstepqyqpgenl