PDB entry 3tyz

View 3tyz on RCSB PDB site
Description: Crystal Structure of the Yersinia pestis Dihydropteroate synthetase with substrate transition state complex.
Class: transferase/transferase substrate
Keywords: Dihydropteroate synthase, transition state complex, pABA, Tim barrel, TRANSFERASE-TRANSFERASE SUBSTRATE complex
Deposited on 2011-09-26, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tyza_
  • Chain 'B':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tyzb_
  • Heterogens: XHP, POP, PAB, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tyzA (A:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyzA (A:)
    mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
    strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
    qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
    kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
    acaviaamqgaqiirvhdvketveamciveatrsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tyzB (B:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyzB (B:)
    mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
    strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
    qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
    kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
    acaviaamqgaqiirvhdvketveamciveatrsak