PDB entry 3tyw

View 3tyw on RCSB PDB site
Description: Crystal Structure of CYP105N1 from Streptomyces coelicolor A3(2)
Class: oxidoreductase
Keywords: P450 monooxygenase, OXIDOREDUCTASE
Deposited on 2011-09-26, released 2012-07-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.282
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWP1 (Start-410)
      • expression tag (411-412)
    Domains in SCOPe 2.03: d3tywa_
  • Chain 'B':
    Compound: putative cytochrome P450
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWP1 (Start-410)
      • expression tag (411-412)
    Domains in SCOPe 2.03: d3tywb_
  • Chain 'C':
    Compound: putative cytochrome P450
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWP1 (Start-410)
      • expression tag (411-413)
    Domains in SCOPe 2.03: d3tywc_
  • Chain 'D':
    Compound: putative cytochrome P450
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWP1 (Start-410)
      • expression tag (411-414)
    Domains in SCOPe 2.03: d3tywd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tywA (A:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tywA (A:)
    pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
    irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
    ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
    algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
    mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
    addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
    llrrvptlrlagerdqvvvkhdsatfgleelmvtwhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tywB (B:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tywB (B:)
    pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
    irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
    ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
    algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
    mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
    addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
    llrrvptlrlagerdqvvvkhdsatfgleelmvtwhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tywC (C:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tywC (C:)
    pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
    irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
    ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
    algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
    mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
    addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
    llrrvptlrlagerdqvvvkhdsatfgleelmvtwhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tywD (D:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tywD (D:)
    pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
    irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
    ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
    algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
    mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
    addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
    llrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhh