PDB entry 3tyu

View 3tyu on RCSB PDB site
Description: Crystal Structure of Dihydropteroate synthetase with Product1
Class: transferase
Keywords: pABA inhibitor, dihydropteroate analog, Tim barrel, transferase
Deposited on 2011-09-26, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tyua_
  • Chain 'B':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CKJ1 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3tyub1, d3tyub2
  • Heterogens: PT1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tyuA (A:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyuA (A:)
    mhltargltldlsrpqvmgilnvtpdshnnldqalqhaqrmlsagatlidiggestrpga
    aevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqepgal
    eaaaktglpvclmhmqgmqhspyyddlmtdinrffqhhiercvaagiaknkllldpgfgf
    gknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsvacaviaamqg
    aqiirvhdvketveamciveatrsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tyuB (B:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyuB (B:)
    shmhltargltldlsrpqvmgilnnnldqalqhaqrmlsagatlidigeldrvvpvveal
    aqrfdvwlsvdtskaavitesahagahlindirslqepgaleaaaktglpvclmhmqdlm
    tdinrffqhhiercvaagiaknkllldpgfgfgknlahnyqllahlselhhfelpllvgm
    srksmvgqllnvppqqrvigsvacaviaamqgaqiirvhdvketveamciveatrsak