PDB entry 3tyi

View 3tyi on RCSB PDB site
Description: Crystal Structure of Cytochrome c - p-Sulfonatocalix[4]arene Complexes
Class: electron transport
Keywords: All alpha, Electron carrier protein, Mitochondrion, ELECTRON TRANSPORT
Deposited on 2011-09-26, released 2012-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (106)
  Domains in SCOPe 2.04: d3tyia_
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (106)
  Domains in SCOPe 2.04: d3tyib_
• Heterogens: HEM, T3Y, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tyiA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tyiB (B:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate