PDB entry 3tyi

View 3tyi on RCSB PDB site
Description: Crystal Structure of Cytochrome c - p-Sulfonatocalix[4]arene Complexes
Class: electron transport
Keywords: All alpha, Electron carrier protein, Mitochondrion, ELECTRON TRANSPORT
Deposited on 2011-09-26, released 2012-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3tyia_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3tyib_
  • Heterogens: HEM, T3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tyiA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tyiB (B:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate