PDB entry 3tyf

View 3tyf on RCSB PDB site
Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
Class: immune system
Keywords: Immunoglobulin-like, Antigen recognition, CD1d, Membrane, IMMUNE SYSTEM
Deposited on 2011-09-24, released 2012-04-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iNKT Cell Receptor Alpha Chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TYF
    Domains in SCOPe 2.04: d3tyfa1, d3tyfa2
  • Chain 'B':
    Compound: iNKT Cell Receptor Beta Chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TYF
    Domains in SCOPe 2.04: d3tyfb1, d3tyfb2
  • Chain 'C':
    Compound: iNKT Cell Receptor Alpha Chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TYF
    Domains in SCOPe 2.04: d3tyfc1, d3tyfc2
  • Chain 'D':
    Compound: iNKT Cell Receptor Beta Chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TYF
    Domains in SCOPe 2.04: d3tyfd1, d3tyfd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tyfA (A:)
    mgknqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentks
    ngrytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspessale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyfA (A:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqnpdp
    avyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnkd
    facanafnnsiipedtffp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tyfB (B:)
    mseadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekg
    dlssestvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle
    dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
    plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
    saeawgradsvdklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyfB (B:)
    diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstkgdlses
    tvsrirtehfpltlesarpshtsqylcasseegalvgtqyfgpgtrllvledlknvfppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tyfC (C:)
    mgknqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentks
    ngrytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspessale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyfC (C:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgslgrlyfgrgtqltvwpdiqnpdpa
    vyqlrdsksksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavawsnsdfa
    canafnnsiipedtffp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tyfD (D:)
    mseadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekg
    dlssestvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle
    dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
    plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
    saeawgradsvdklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyfD (D:)
    diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekglsse
    stvsrirtehfpltlesarpshtsqylcasseegalkegtqyfgpgtrllvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad