PDB entry 3tye

View 3tye on RCSB PDB site
Description: Dihydropteroate Synthase in complex with DHP-STZ
Class: transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, tim barrel, transferase
Deposited on 2011-09-24, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.256
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tyea_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tyeb_
  • Heterogens: XTZ, SO4, XHP, YTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tyeA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyeA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpgsynevdaavrhakemrdegahiidiggest
    rpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgaka
    epkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgi
    gfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgie
    kgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tyeB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tyeB (B:)
    kwdydlrcgeytlnlnektlimgilnvggsynevdaavrhakemrdegahiidiggests
    veeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaeva
    ahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeq
    nleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrv
    hdvkemsrmakmmdamigk