PDB entry 3tyd

View 3tyd on RCSB PDB site
Description: Dihydropteroate Synthase in complex with PPi and DHP+
Class: transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, tim barrel, transferase
Deposited on 2011-09-24, released 2012-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tyda_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tydb_
  • Heterogens: POP, XHP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tydA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tydA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsgsynevdaavrhakemrdegahiidig
    gestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiw
    gakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniil
    dpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvc
    lgiekgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tydB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tydB (B:)
    kwdydlrcgeytlnlnektlimgilnvtpdggsynevdaavrhakemrdegahiidigge
    stsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia
    evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfakt
    peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef
    vrvhdvkemsrmakmmdamigk