PDB entry 3tyb

View 3tyb on RCSB PDB site
Description: Dihydropteroate Synthase in complex with pHBA and DHP+
Class: transferase
Keywords: anthracis, folate biosynthesis, dihydropteroate, pterine, tim barrel, transferase
Deposited on 2011-09-24, released 2012-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.248
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81VW8
      • expression tag (20)
    Domains in SCOPe 2.06: d3tyba1, d3tyba2
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: folP, BAS0071, BA_0071, GBAA_0071
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tybb_
  • Heterogens: XHP, PHB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tybA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tybA (A:)
    mkwdydlrcgeytlnlnektlimgilnvtpsdggsynevdaavrhakemrdegahiidig
    gestvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaep
    kiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigf
    aktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekg
    cefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tybB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tybB (B:)
    kwdydlrcgeytlnlnektlimgilnvtpdggsynevdaavrhakemrdegahiidigge
    ssveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiae
    vaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktp
    eqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefv
    rvhdvkemsrmakmmdamigk