PDB entry 3ty2

View 3ty2 on RCSB PDB site
Description: Structure of a 5'-nucleotidase (surE) from Coxiella burnetii
Class: Hydrolase
Keywords: survival protein, phosphatase, Hydrolase
Deposited on 2011-09-23, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Coxiella burnetii [TaxId:777]
    Gene: surE, CBU_1671
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ty2a_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Coxiella burnetii [TaxId:777]
    Gene: surE, CBU_1671
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ty2b_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ty2A (A:)
    snamkktatpklrlllsnddgvyakglailaktladlgevdvvapdrnrsgasnsltlna
    plhiknlengmisvegtptdcvhlaitgvlpempdmvvaginagpnlgddvwysgtvaaa
    megrflglpalavslggelfryyetaakvvyqliqriekdplppstilninvpdlpyeel
    kgfevtrlgtrhraeptirqidprghpiywvgaagpeqdsgpgtdffamnhhcvsitplr
    vdlthyeafdqlaswvkrlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty2A (A:)
    klrlllsnddgvyakglailaktladlgevdvvapdrnrsgasnsltlnaplhiknleng
    misvegtptdcvhlaitgvlpempdmvvaginagpnlgddvwysgtvaaamegrflglpa
    lavslggelfryyetaakvvyqliqriekdplppstilninvpdlpyeelkgfevtrlgt
    rhraeptirqidprghpiywvgaagpeqdsgpgtdffamnhhcvsitplrvdlthyeafd
    qlaswvkrlem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ty2B (B:)
    snamkktatpklrlllsnddgvyakglailaktladlgevdvvapdrnrsgasnsltlna
    plhiknlengmisvegtptdcvhlaitgvlpempdmvvaginagpnlgddvwysgtvaaa
    megrflglpalavslggelfryyetaakvvyqliqriekdplppstilninvpdlpyeel
    kgfevtrlgtrhraeptirqidprghpiywvgaagpeqdsgpgtdffamnhhcvsitplr
    vdlthyeafdqlaswvkrlem
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ty2B (B:)
    klrlllsnddgvyakglailaktladlgevdvvapdrnrsgasnsltlnaplhiknleng
    misvegtptdcvhlaitgvlpempdmvvaginagpnlgddvwysgtvaaamegrflglpa
    lavslggelfryyetaakvvyqliqriekdplppstilninvpdlpyeelkgfevtrlgt
    rhraeptirqidprghpiywvgaagpeqdsgpgtdffamnhhcvsitplrvdlthyeafd
    qlaswvkrlem