PDB entry 3txo

View 3txo on RCSB PDB site
Description: PKC eta kinase in complex with a naphthyridine
Class: transferase/transferase inhibitor
Keywords: kinase, phosphotransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-23, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C eta type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCH, PKCL, PRKCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24723
      • engineered mutation (344)
    Domains in SCOPe 2.06: d3txoa_
  • Heterogens: 07U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3txoA (A:)
    gpkesskegngigvnssnrlgidnfefirvlgkgsfgkvmlarvketgdlyavkvlkkdv
    ilqdddvectmtekrilslarnhpfltqlfccfqtpdrlffvmefvnggdlmfhiqksrr
    fdeararfyaaeiisalmflhdkgiiyrdlkldnvlldheghckladfgmckegicngvt
    tatfcgtpdyiapeilqemlygpavdwwamgvllyemlcghapfeaeneddlfeailnde
    vvyptwlhedatgilksfmtknptmrlgsltqggehailrhpffkeidwaqlnhrqiepp
    frpriksredvsnfdpdfikeepvltpideghlpminqdefrnfeyvspelqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3txoA (A:)
    dnfefirvlgkgsfgkvmlarvketgdlyavkvlkkdvilqdddvectmtekrilslarn
    hpfltqlfccfqtpdrlffvmefvnggdlmfhiqksrrfdeararfyaaeiisalmflhd
    kgiiyrdlkldnvlldheghckladfgmckegicgtpdyiapeilqemlygpavdwwamg
    vllyemlcghapfeaeneddlfeailndevvyptwlhedatgilksfmtknptmrlgslt
    qggehailrhpffkeidwaqlnhrqieppfrpriksredvsnfdpdfikeepvltpideg
    hlpminqdefrnfeyvsp