PDB entry 3twu

View 3twu on RCSB PDB site
Description: Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human MCL1
Class: signaling protein/peptide
Keywords: ankyrin repeat, protein-protein interaction, substrate recruitment, poly(ADP-ribosyl)ation, SIGNALING PROTEIN-PEPTIDE complex
Deposited on 2011-09-22, released 2011-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3twua_
  • Chain 'B':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3twuA (A:)
    gamgsgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvv
    eyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaak
    gkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twuA (A:)
    nseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqh
    gadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeic
    klllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaa
    

  • Chain 'B':
    No sequence available.