PDB entry 3twt

View 3twt on RCSB PDB site
Description: Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human MCL1 (chimeric peptide)
Class: signaling protein/peptide
Keywords: ankyrin repeat, protein-protein interaction, poly(ADP-ribosyl)ation, substrate recruitment, SIGNALING PROTEIN-PEPTIDE complex
Deposited on 2011-09-22, released 2011-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3twta_
  • Chain 'B':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3twtb_
  • Chain 'C':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2K2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d3twtc_
  • Chain 'D':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2K2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d3twtd_
  • Chain 'E':
    Compound: human MCL1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWT (Start-15)
  • Chain 'F':
    Compound: human MCL1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWT (Start-15)
  • Chain 'G':
    Compound: human MCL1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWT (0-15)
  • Chain 'H':
    Compound: human MCL1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWT (Start-15)
  • Heterogens: 2PE, EDO, SO4, PE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3twtA (A:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twtA (A:)
    nseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqh
    gadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeic
    klllqhgadptkknrdgntpldlvkdgdtdiqdllr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3twtB (B:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twtB (B:)
    gnseadrqlleaakagdvetvkklctvqsvncrdirqstplhfaagynrvsvveyllqhg
    advhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeick
    lllqhgadptkknrdgntpldlvkdgdtdiqdllr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3twtC (C:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twtC (C:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3twtD (D:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twtD (D:)
    gamgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvvey
    llqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgk
    yeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.