PDB entry 3twq

View 3twq on RCSB PDB site
Description: Crystal structure of ARC4 from human Tankyrase 2 (apo form)
Class: signaling protein
Keywords: ankyrin repeat, protein-protein interaction, poly(ADP-ribosyl)ation, substrate recruitment, SIGNALING PROTEIN
Deposited on 2011-09-22, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2K2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3twqa1, d3twqa2
  • Chain 'B':
    Compound: tankyrase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP5B, TANK2, TNKL, TNKS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2K2 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3twqb1, d3twqb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3twqA (A:)
    gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
    vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
    akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaalldaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twqA (A:)
    gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
    vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
    akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3twqB (B:)
    gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
    vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
    akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllrgdaalldaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twqB (B:)
    gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
    vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
    akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr