PDB entry 3twi

View 3twi on RCSB PDB site
Description: Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores
Class: immune system
Keywords: Leucine-Rich Repeat, Antigen-binding, Secreted, IMMUNE SYSTEM
Deposited on 2011-09-21, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcla protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: bclA, BA_1222, GBAA_1222
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81JD7 (Start-154)
      • engineered mutation (125)
      • expression tag (155)
  • Chain 'B':
    Compound: bcla protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: bclA, BA_1222, GBAA_1222
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81JD7 (Start-154)
      • engineered mutation (125)
      • expression tag (155)
  • Chain 'C':
    Compound: bcla protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: bclA, BA_1222, GBAA_1222
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81JD7 (Start-154)
      • engineered mutation (125)
      • expression tag (155)
  • Chain 'D':
    Compound: Variable lymphocyte receptor B
    Species: Petromyzon marinus [TaxId:7757]
    Gene: VLR-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3twid_
  • Chain 'E':
    Compound: Variable lymphocyte receptor B
    Species: Petromyzon marinus [TaxId:7757]
    Gene: VLR-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3twie1
  • Chain 'F':
    Compound: Variable lymphocyte receptor B
    Species: Petromyzon marinus [TaxId:7757]
    Gene: VLR-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3twif_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3twiD (D:)
    amvhhhhhhsaacpsqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvf
    dsltqltylnlavnqltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylf
    nnpwdcecsdilylknwivqhasivnplgnggvdnvkcsgtntpvravteastspskcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twiD (D:)
    acpsqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvfdsltqltylnl
    avnqltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylfnnpwdcecsdi
    lylknwivqhasivnplgnggvdnvkcsgtntpvravteastspskcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3twiE (E:)
    amvhhhhhhsaacpsqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvf
    dsltqltylnlavnqltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylf
    nnpwdcecsdilylknwivqhasivnplgnggvdnvkcsgtntpvravteastspskcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twiE (E:)
    acpsqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvfdsltqltylnl
    avnqltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylfnnpwdcecsdi
    lylknwivqhasivnplgnggvdnvkcsgtntpvravteastspsc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3twiF (F:)
    amvhhhhhhsaacpsqcscsgttvncqerslasvpagiptttqvlhlyinqitklepgvf
    dsltqltylnlavnqltalpvgvfdkltklthlalhinqlksipmgvfdnlkslthiylf
    nnpwdcecsdilylknwivqhasivnplgnggvdnvkcsgtntpvravteastspskcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twiF (F:)
    sqcscstvncqrslsvpptvlhlyinqitpgvltylnlavnqltalpvgvlthlalhinq
    lsipmgvlthiylfnnpwecslyknwivqhasivnplgnggvdnvktntpvraveac