PDB entry 3twc

View 3twc on RCSB PDB site
Description: Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with Man9
Class: immune system
Keywords: Fab, HIV-1 neutralizing antibody, gp120, IMMUNE SYSTEM
Deposited on 2011-09-21, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: PGT127 heavy chain, Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWC (0-134)
    • Uniprot P01857 (135-End)
  • Chain 'L':
    Compound: PGT127 light chain, Ig lambda-2 chain C regions
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLC2
    Database cross-references and differences (RAF-indexed):
    • PDB 3TWC (Start-103)
    • Uniprot P0CG05 (105-End)
    Domains in SCOPe 2.07: d3twcl1, d3twcl2
  • Heterogens: AML, MAN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3twcL (L:)
    esaltqppsasgspgqsitisctgtsnnfvswyqqypgkapklviyevnkrpsgvpdrfs
    gsksgstasltvsglqaddegvyycsslvgnwdvifgggtkltvlgqpkaapsvtlfpps
    seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
    peqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3twcL (L:)
    altqppsasgspgqsitisctgtsnnfvswyqqypgkapklviyevnkrpsgvpdrfsgs
    ksgstasltvsglqaddegvyycsslvgnwdvifgggtkltvlgqpkaapsvtlfppsse
    elqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvaptec