PDB entry 3tvx

View 3tvx on RCSB PDB site
Description: The structure of PDE4A with pentoxifylline at 2.84A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-20, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4A, DPDE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27815 (5-337)
      • expression tag (4)
    Domains in SCOPe 2.07: d3tvxa1, d3tvxa2
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4A, DPDE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27815 (5-337)
      • expression tag (4)
    Domains in SCOPe 2.07: d3tvxb1, d3tvxb2
  • Heterogens: ZN, MG, PNX, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tvxA (A:)
    gagtmniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdll
    kkfripvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleila
    alfaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnl
    skrqrqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrn
    mvhcadlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgf
    idyivhplwetwadlvhpdaqeildtlednrdwyysai
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvxA (A:)
    mniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfr
    ipvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrq
    rqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhc
    adlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvhpdaqeildtlednrdwyysai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tvxB (B:)
    gagtmniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdll
    kkfripvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleila
    alfaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnl
    skrqrqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrn
    mvhcadlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgf
    idyivhplwetwadlvhpdaqeildtlednrdwyysai
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvxB (B:)
    mniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfr
    ipvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrq
    rqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhc
    adlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvhpdaqeildtlednrdwyysai