PDB entry 3tvt

View 3tvt on RCSB PDB site
Description: Structural basis for Discs Large interaction with Pins
Class: antitumor protein/protein binding
Keywords: Dlg, Src-homology-3, Guanylate kinase, Phosphorylation-dependent, Cell membrane, ANTITUMOR PROTEIN-PROTEIN BINDING complex
Deposited on 2011-09-20, released 2012-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large 1 tumor suppressor protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: dlg1, l(1)dlg1, CG1725
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tvta1, d3tvta2
  • Chain 'B':
    Compound: partner of inscuteable
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: raps, pins, CG5692
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NH88
      • engineered mutation (25)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tvtA (A:)
    tqkrslyvralfdydpnrddglpsrglpfkhgdilhvtnasddewwqarrvlgdnedeqi
    givpskrrwerkmrardrsvkseenvlsyeavqrlsinytrpviilgplkdrinddlise
    ypdkfgscvphttrpkreyevdgrdyhfvssreqmerdiqnhlfieagqyndnlygtsva
    svrevaekgkhcildvsgnaikrlqvaqlypvavfikpksvdsvmemnrrmteeqakkty
    eraikmeqefgeyftgvvqgdtieeiyskvksmiwsqsgptiwvpskeslgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tvtA (A:)
    slyvralfdydpglpfkhgdilhvtnasddewwqarrvlgivpskrrwerkmravlsyea
    vqrlsinytrpviilgplkdrinddliseypdkfgscvphttrpkreyevdgrdyhfvss
    reqmerdiqnhlfieagqyndnlygtsvasvrevaekgkhcildvsgnaikrlqvaqlyp
    vavfikpksvdsvmemnrrmteeqakktyeraikmeqefgeyftgvvqgdtieeiyskvk
    smiwsqsgptiwvps
    

  • Chain 'B':
    No sequence available.