PDB entry 3tvo

View 3tvo on RCSB PDB site
Description: Human Carbonic Anhydrase II Proton Transfer Double Mutant
Class: lyase
Keywords: globular protein, LYASE
Deposited on 2011-09-20, released 2012-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.169
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-257)
      • engineered mutation (4)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d3tvox_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3tvoX (X:)
hhwgfgkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk