PDB entry 3tv8

View 3tv8 on RCSB PDB site
Description: Pharmacological Chaperoning in Human alpha-Galactosidase
Class: hydrolase
Keywords: pharmacological chaperone, (beta/alpha)8 barrel, carbohydrate-binding protein, glycosidase, glycoprotein, n-linked glycosylation, lysosome, HYDROLASE
Deposited on 2011-09-19, released 2012-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06280 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d3tv8a1, d3tv8a2
  • Chain 'B':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06280 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d3tv8b1, d3tv8b2
  • Heterogens: NAG, SO4, 2PE, DGJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tv8A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfagcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tv8A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfagcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tv8B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfagcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdllhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tv8B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfagcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmq