PDB entry 3tuc

View 3tuc on RCSB PDB site
Description: Crystal structure of SYK kinase domain with 1-benzyl-N-(5-(6,7-dimethoxyquinolin-4-yloxy)pyridin-2-yl)-2-oxo-1,2-dihydropyridine-3-carboxamide
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-16, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tuca_
  • Heterogens: FPW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tucA (A:)
    mdtevyespyadpeeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavk
    ilkneandpalkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqq
    nrhvkdkniielvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalrad
    enyykaqthgkwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevt
    amlekgermgcpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tucA (A:)
    irpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdel
    laeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhq
    vsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglpvkwyapecinyykfssksdvw
    sfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydvenr
    pgfaavelrlrnyyydv