PDB entry 3tu2

View 3tu2 on RCSB PDB site
Description: Crystal structure of glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium and L-lyxarohydroxamate
Class: lyase
Keywords: enolase fold, LYASE
Deposited on 2011-09-15, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_2751, Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d3tu2a1, d3tu2a2, d3tu2a3
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_2751, Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d3tu2b1, d3tu2b2, d3tu2b3
  • Heterogens: MG, LLH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tu2A (A:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tu2A (A:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tu2B (B:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tu2B (B:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr