PDB entry 3tt7

View 3tt7 on RCSB PDB site
Description: Structure of ClpP from Bacillus subtilis in complex with DFP
Class: hydrolase
Keywords: Hydrolase
Deposited on 2011-09-14, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tt7g_
  • Heterogens: DFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tt7A (A:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7A (A:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tt7B (B:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7B (B:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tt7C (C:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7C (C:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tt7D (D:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7D (D:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tt7E (E:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7E (E:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tt7F (F:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7F (F:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3tt7G (G:)
    mnliptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekei
    slyinspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsev
    mihqplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeea
    leyglidkilthtedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt7G (G:)
    iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
    tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
    qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt