PDB entry 3tt5

View 3tt5 on RCSB PDB site
Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with Berberine
Class: hydrolase/hydrolase inhibitor
Keywords: Phospholipase A2, Lipid hydrolysis, Berberine, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-14, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tt5a_
  • Heterogens: CA, BER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tt5A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc