PDB entry 3tt4

View 3tt4 on RCSB PDB site
Description: Human MMP8 in complex with L-glutamate motif inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: pseudo dipeptides, potent inhibitors, metzincin, Zinc metalloprotease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-14, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG1, MMP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tt4a_
  • Heterogens: ZN, CA, E1S, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tt4A (A:)
    gnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafy
    qrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghsl
    glahssdpgalmypnyafretsnyslpqddidgiqaiyg