PDB entry 3tsx

View 3tsx on RCSB PDB site
Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
Class: virus
Keywords: beta barrel, VIRUS
Deposited on 2011-09-13, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.251
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxa_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxe_
  • Chain 'F':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxf_
  • Chain 'G':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxg_
  • Chain 'H':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxh_
  • Chain 'I':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxi_
  • Chain 'J':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxj_
  • Chain 'K':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxk_
  • Chain 'L':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxl_
  • Chain 'M':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxm_
  • Chain 'N':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxn_
  • Chain 'O':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxo_
  • Chain 'P':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxp_
  • Chain 'Q':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxq_
  • Chain 'R':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxr_
  • Chain 'S':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxs_
  • Chain 'T':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus - 6 [TaxId:68558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsxt_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxA (A:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxB (B:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxC (C:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxD (D:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxE (E:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxF (F:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxG (G:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxH (H:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxI (I:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxJ (J:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxK (K:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxL (L:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxM (M:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxN (N:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxO (O:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxP (P:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxQ (Q:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxR (R:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxS (S:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsxT (T:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl