PDB entry 3tss

View 3tss on RCSB PDB site
Description: toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
Class: toxin
Keywords: toxin, superantigen, signal
Deposited on 1996-12-11, released 1997-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (Start-193)
      • engineered (68)
      • engineered (79)
      • correction (115)
      • engineered (131)
      • engineered (139)
    Domains in SCOPe 2.06: d3tssa1, d3tssa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tssA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrikksqhtsegtwihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfkirhqltqthglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tssA (A:)
    nikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvdl
    ntkrikksqhtsegtwihfqisgvtnteklptpielplkvkvhgkdsplkywpkfdkkql
    aistldfkirhqltqthglyrssdktggywkitmndgstyqsdlskkfeyntekppinid
    eiktieaein