PDB entry 3ts5

View 3ts5 on RCSB PDB site
Description: Crystal Structure of a Light Chain Domain of Scallop Smooth Muscle Myosin
Class: structural protein
Keywords: alpha helix, Myosin regulation, Catch muscle, STRUCTURAL PROTEIN
Deposited on 2011-09-12, released 2011-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ts5b_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ts5c_
  • Chain 'D':
    Compound: myosin heavy chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: myosin regulatory light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ts5e_
  • Chain 'F':
    Compound: myosin essential light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ts5f_
  • Heterogens: MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ts5B (B:)
    adkeraqratsnvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddke
    ltamlkeapgplnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllen
    mgdnfnkdemrmtfkeapveggkfdyvrfvamikgsgddda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts5B (B:)
    arlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnf
    tmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtf
    keapveggkfdyvrfvamikgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ts5C (C:)
    pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
    evdeiinltdlqedlegnvkyeefvkkvmtgpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts5C (C:)
    klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
    vdeiinltdlqedlegnvkyeefvkkvmtgpy
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ts5E (E:)
    adkeraqratsnvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddke
    ltamlkeapgplnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllen
    mgdnfnkdemrmtfkeapveggkfdyvrfvamikgsgddda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts5E (E:)
    snvfarlpqklmqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapg
    plnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdem
    rmtfkeapveggkfdyvrfvamikgs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ts5F (F:)
    pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
    evdeiinltdlqedlegnvkyeefvkkvmtgpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts5F (F:)
    klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
    vdeiinltdlqedlegnvkyeefvkkvmtgp