PDB entry 3ts4

View 3ts4 on RCSB PDB site
Description: Human MMP12 in complex with L-glutamate motif inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: pseudo dipeptides, potent inhibitors, metzincin, Zinc protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-12, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.18
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: HME, MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d3ts4a1, d3ts4a2
  • Heterogens: ZN, CA, EEG, IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ts4A (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg