PDB entry 3tri

View 3tri on RCSB PDB site
Description: Structure of a pyrroline-5-carboxylate reductase (proC) from Coxiella burnetii
Class: oxidoreductase
Keywords: Amino acid biosynthesis, OXIDOREDUCTASE
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_2090, proC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tria1, d3tria2
  • Chain 'B':
    Compound: pyrroline-5-carboxylate reductase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_2090, proC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3trib1, d3trib2
  • Heterogens: NAP, PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3triA (A:)
    mntsnitfigggnmarnivvgliangydpnricvtnrsldkldffkekcgvhttqdnrqg
    alnadvvvlavkphqikmvceelkdilsetkilvislavgvttpliekwlgkasrivram
    pntpssvragatglfanetvdkdqknlaesimravglviwvssedqiekiaalsgsgpay
    iflimealqeaaeqlgltketaellteqtvlgaarmaleteqsvvqlrqfvtspggtteq
    aikvlesgnlrelfikaltaavnrakelsktvdqenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3triA (A:)
    ntsnitfigggnmarnivvgliangydpnricvtnrsldkldffkekcgvhttqdnrqga
    lnadvvvlavkphqikmvceelkdilsetkilvislavgvttpliekwlgkasrivramp
    ntpssvragatglfanetvdkdqknlaesimravglviwvssedqiekiaalsgsgpayi
    flimealqeaaeqlgltketaellteqtvlgaarmaleteqsvvqlrqfvtspggtteqa
    ikvlesgnlrelfikaltaavnrakelsktvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3triB (B:)
    mntsnitfigggnmarnivvgliangydpnricvtnrsldkldffkekcgvhttqdnrqg
    alnadvvvlavkphqikmvceelkdilsetkilvislavgvttpliekwlgkasrivram
    pntpssvragatglfanetvdkdqknlaesimravglviwvssedqiekiaalsgsgpay
    iflimealqeaaeqlgltketaellteqtvlgaarmaleteqsvvqlrqfvtspggtteq
    aikvlesgnlrelfikaltaavnrakelsktvdqenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3triB (B:)
    ntsnitfigggnmarnivvgliangydpnricvtnrsldkldffkekcgvhttqdnrqga
    lnadvvvlavkphqikmvceelkdilsetkilvislavgvttpliekwlgkasrivramp
    ntpssvragatglfanetvdkdqknlaesimravglviwvssedqiekiaalsgsgpayi
    flimealqeaaeqlgltketaellteqtvlgaarmaleteqsvvqlrqfvtspggtteqa
    ikvlesgnlrelfikaltaavnrakelskt