PDB entry 3tre

View 3tre on RCSB PDB site
Description: Structure of a translation elongation factor P (efp) from Coxiella burnetii
Class: translation
Keywords: Protein synthesis, TRANSLATION
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor P
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_1816, efp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3trea1, d3trea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3treA (A:)
    snamathstnefrgglkvmvdgdpcsiidnefvkpgkgqafnrvkfrnlktgrvlertfk
    sgetlpaadvvevemqylyndgefwhfmtsenyeqhaaskeavaeakqwlkeealcmvtm
    wngvplsveppnfvelkitetepgvrgdtatggtkrakletgavvrvplflnegeiikvd
    trrgeyvsrak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3treA (A:)
    thstnefrgglkvmvdgdpcsiidnefvkpgkgqafnrvkfrnlktgrvlertfksgetl
    paadvvevemqylyndgefwhfmtsenyeqhaaskeavaeakqwlkeealcmvtmwngvp
    lsveppnfv