PDB entry 3tqy

View 3tqy on RCSB PDB site
Description: Structure of a single-stranded DNA-binding protein (ssb), from Coxiella burnetii
Class: transferase
Keywords: DNA replication, TRANSFERASE
Deposited on 2011-09-09, released 2011-09-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0271, ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tqya_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0271, ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tqyb_
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0271, ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tqyc_
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0271, ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tqyd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqyA (A:)
    snamargvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhri
    affnrlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmldnrgggns
    gnygnhseggasnkqsaptssqtptagddssvadfddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqyA (A:)
    margvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaff
    nrlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqyB (B:)
    snamargvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhri
    affnrlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmldnrgggns
    gnygnhseggasnkqsaptssqtptagddssvadfddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqyB (B:)
    argvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffn
    rlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tqyC (C:)
    snamargvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhri
    affnrlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmldnrgggns
    gnygnhseggasnkqsaptssqtptagddssvadfddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqyC (C:)
    rgvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffnr
    laeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tqyD (D:)
    snamargvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhri
    affnrlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmldnrgggns
    gnygnhseggasnkqsaptssqtptagddssvadfddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqyD (D:)
    rgvnkvilignlgqdpevrytpngnavanvtlatsttertewhriaffnrlaeivgeylr
    kgskiyiegslrtrkwqdkngvdrytteiianemhmld