PDB entry 3tqv

View 3tqv on RCSB PDB site
Description: Structure of the nicotinate-nucleotide pyrophosphorylase from Francisella tularensis.
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: nadC, FTT_1468c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tqva1, d3tqva2
  • Chain 'B':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: nadC, FTT_1468c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tqvb1, d3tqvb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqvA (A:)
    madvmlntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcg
    qdfanevinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsgt
    atvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhir
    saggiakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsiar
    gkvalevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqvA (A:)
    ntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcgqdfane
    vinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsgtatvtnk
    lvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhigiakavt
    kakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsiargkvalevsgn
    idrnsivaiaktgvdfisvgaitkhikaidlslqvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqvB (B:)
    madvmlntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcg
    qdfanevinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsgt
    atvtnklvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhir
    saggiakavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsiar
    gkvalevsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqvB (B:)
    ntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcgqdfane
    vinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsgtatvtnk
    lvklisqyktklldtrktipgfrlaqkyavrcgggfnhriglfdaylikenhirsaggia
    kavtkakkldsnkvvevevtnldelnqaiaakadivmldnfsgedidiavsiargkvale
    vsgnidrnsivaiaktgvdfisvgaitkhikaidlslqvq