PDB entry 3tqu

View 3tqu on RCSB PDB site
Description: Structure of a HAM1 protein from Coxiella burnetii
Class: hydrolase
Keywords: HAM1 protein, HYDROLASE
Deposited on 2011-09-09, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_0043
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tqua_
  • Chain 'B':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_0043
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tqub_
  • Chain 'C':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_0043
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tquc_
  • Chain 'D':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_0043
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tqud_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tquA (A:)
    snamleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarha
    akqtglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsas
    fhcvialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqek
    naishrgqaleqlstvlteaflv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tquA (A:)
    mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
    tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
    vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
    shrgqaleqlstvltea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tquB (B:)
    snamleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarha
    akqtglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsas
    fhcvialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqek
    naishrgqaleqlstvlteaflv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tquB (B:)
    mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
    tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
    vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
    shrgqaleqlstvltea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tquC (C:)
    snamleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarha
    akqtglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsas
    fhcvialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqek
    naishrgqaleqlstvlteaflv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tquC (C:)
    mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
    tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
    vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
    shrgqaleqlstvltea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tquD (D:)
    snamleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarha
    akqtglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsas
    fhcvialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqek
    naishrgqaleqlstvlteaflv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tquD (D:)
    mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
    tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
    vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
    shrgqaleqlstvltea