PDB entry 3tq8

View 3tq8 on RCSB PDB site
Description: Structure of the dihydrofolate reductase (folA) from Coxiella burnetii in complex with trimethoprim
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: dihydrofolate reductase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-09-09, released 2011-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_1993, folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83AB2 (0-160)
      • expression tag (161-172)
    Domains in SCOPe 2.05: d3tq8a_
  • Heterogens: NDP, TOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3tq8A (A:)
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdeknpypfqflelrrlenlyfqghhhhhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3tq8A (A:)
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdnpypfqflelrrlenlyfqghhhhh