PDB entry 3tq7

View 3tq7 on RCSB PDB site
Description: EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
Class: protein binding
Keywords: CAP-Gly domain, protein-protein interaction, microtubule binding, cytoskeleton, PROTEIN BINDING
Deposited on 2011-09-09, released 2012-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tq7a_
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tq7b_
  • Chain 'P':
    Compound: Dynactin subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14203 (0-70)
      • engineered mutation (22)
    Domains in SCOPe 2.05: d3tq7p_
  • Chain 'Q':
    Compound: Dynactin subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14203 (0-70)
      • engineered mutation (22)
    Domains in SCOPe 2.05: d3tq7q_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tq7A (A:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
    egfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tq7A (A:)
    mqqvnvlkltvedlekerdfyfgklrnielicqenepvlqrivdilyatdeqeey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tq7B (B:)
    aqilelnqqlvdlkltvdglekerdfyfsklrdielicqehesenspvisgiigilyate
    egfappeddeieehqqedqdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tq7B (B:)
    elnqqlvdlkltvdglekerdfyfsklrdielicqehpvisgiigilyateqdey
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tq7P (P:)
    lrvgsrvevigkghrgtvayvgmtlfatgkwvgvildeakgkndgtvqgrkyftcdeghg
    ifvrqsqiqvf
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tq7Q (Q:)
    lrvgsrvevigkghrgtvayvgmtlfatgkwvgvildeakgkndgtvqgrkyftcdeghg
    ifvrqsqiqvf