PDB entry 3tq0

View 3tq0 on RCSB PDB site
Description: Crystal structure of Leishmania major dihydroorotate dehydrogenase in complex with fumarate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-09-08, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: DHODH, lmjf16.0530, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-345)
      • expression tag (33)
    Domains in SCOPe 2.07: d3tq0a1, d3tq0a2
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: DHODH, lmjf16.0530, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-345)
      • expression tag (33)
    Domains in SCOPe 2.07: d3tq0b1, d3tq0b2
  • Heterogens: FMN, FUM, GOL, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tq0A (A:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpqvaydfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tq0A (A:)
    smslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpry
    qalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavat
    ekgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaa
    eilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyr
    rcpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkry
    qtldefrgkvrtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tq0B (B:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpqvaydfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tq0B (B:)
    smslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpry
    qalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavat
    ekgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaa
    eilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyr
    rcpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkry
    qtldefrgkvrtl