PDB entry 3tpm

View 3tpm on RCSB PDB site
Description: Crystal structure of MAL RPEL domain in complex with importin-alpha
Class: protein transport/transcription
Keywords: nuclear import, PROTEIN TRANSPORT-TRANSCRIPTION complex
Deposited on 2011-09-08, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-2
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tpma_
  • Chain 'B':
    Compound: mal
    Species: Mus musculus [TaxId:10090]
    Gene: Mkl1
    Database cross-references and differences (RAF-indexed):
    • PDB 3TPM
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tpmA (A:)
    nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
    piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
    afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
    tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
    raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
    nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
    kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
    yf
    

  • Chain 'B':
    No sequence available.