PDB entry 3tpj

View 3tpj on RCSB PDB site
Description: APO structure of BACE1
Class: hydrolase
Keywords: hydrolase, protease, memapsin 2, bace1
Deposited on 2011-09-08, released 2011-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.178
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE, BACE1, KIAA1149
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817
      • engineered mutation (114)
      • engineered mutation (116)
    Domains in SCOPe 2.04: d3tpja_
  • Heterogens: SO4, CL, URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tpjA (A:)
    mgsshhhhhhsagenlyfqgtlpretdeepeepgrrgsfvemvdnlrgksgqgyyvemtv
    gsppqtlnilvdtgssnfavgaaphpflhryyqrqlsstyrdlrkgvyvpytqgawagel
    gtdlvsiphgpnvtvraniaaitesdkffingsnwegilglayaeiarpddslepffdsl
    vkqthvpnlfslqlcgagfplnqsevlasvggsmiiggidhslytgslwytpirrewyye
    viivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaasstekfpdg
    fwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpvedvatsqddcy
    kfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfvtldme
    dcgynipqtdest
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpjA (A:)
    rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
    lsstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsnw
    egilglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytg
    slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavk
    sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
    rpvetsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaa
    vegpfvtldmedcgyni