PDB entry 3tpc

View 3tpc on RCSB PDB site
Description: Crystal structure of a hypothtical protein SMa1452 from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2011-09-07, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpca_
  • Chain 'B':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpcb_
  • Chain 'C':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpcc_
  • Chain 'D':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpcd_
  • Chain 'E':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpce_
  • Chain 'F':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpcf_
  • Chain 'G':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpcg_
  • Chain 'H':
    Compound: Short chain alcohol dehydrogenase-related dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: RA0792, SMa1452
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tpch_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tpcA (A:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcA (A:)
    qlksrvfivtgassglgaavtrmlaqegatvlgldlkppvrfrnadvtneadataalafa
    kqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqge
    pdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgi
    fdtpasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tpcB (B:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcB (B:)
    vfivtgassglgaavtrmlaqegatvlgldlvrfrnadvtneadataalafakqefghvh
    glvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepdadgerg
    vivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifdtpdala
    asvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tpcC (C:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcC (C:)
    lksrvfivtgassglgaavtrmlaqegatvlgldlkppvrfrnadvtneadataalafak
    qefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgep
    dadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgif
    dtpasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tpcD (D:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcD (D:)
    qlksrvfivtgassglgaavtrmlaqegatvlgldlkppvrfrnadvtneadataalafa
    kqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqge
    pdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgi
    fdtpaasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tpcE (E:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcE (E:)
    qlksrvfivtgassglgaavtrmlaqegatvlgldlkppvrfrnadvtneadataalafa
    kqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqge
    pdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgi
    fdtpasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tpcF (F:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcF (F:)
    qlksrvfivtgassglgaavtrmlaqegatvlgldlkvrfrnadvtneadataalafakq
    efghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepd
    adgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifd
    tpasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3tpcG (G:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcG (G:)
    lksrvfivtgassglgaavtrmlaqegatvlgldlkvrfrnadvtneadataalafakqe
    fghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepda
    dgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifdt
    pasvpfpprlgraeeyaalvkhicentmlngevirldgalrm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3tpcH (H:)
    mvmqlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrna
    dvtneadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligt
    fnmirlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaare
    larfgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentm
    lngevirldgalrmapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpcH (H:)
    qlksrvfivtgassglgaavtrmlaqegatvlgldlvrfrnadvtneadataalafakqe
    fghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepda
    dgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifdt
    pasvpfpprlgraeeyaalvkhicentmlngevirldgalrm