PDB entry 3tp7

View 3tp7 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V99E at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2011-09-07, released 2011-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (92)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.03: d3tp7a_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3tp7A (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmenealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >3tp7A (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmenealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws