PDB entry 3tp5

View 3tp5 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E/L36E at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2011-09-07, released 2011-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (20)
      • engineered mutation (22)
      • engineered mutation (32)
      • engineered mutation (35)
      • engineered mutation (40)
      • engineered mutation (43-44)
      • engineered mutation (52)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d3tp5a_
  • Heterogens: THP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tp5A (A:)
    atstkklhkepatlikaidgnteklmykgqpmvfrellvdipefnekygpeaaaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tp5A (A:)
    lhkepatlikaidgnteklmykgqpmvfrellvdipefnekygpeaaaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws