PDB entry 3toz

View 3toz on RCSB PDB site
Description: 2.2 Angstrom Crystal Structure of Shikimate 5-dehydrogenase from Listeria monocytogenes in Complex with NAD.
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, NAD(P)-binding Rossmann-fold domain, Shikimate 5-dehydrogenase, NAD, OXIDOREDUCTASE
Deposited on 2011-09-06, released 2011-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3toza1, d3toza2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozb1, d3tozb2
  • Chain 'C':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozc1, d3tozc2
  • Chain 'D':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozd1, d3tozd2
  • Chain 'E':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3toze1, d3toze2
  • Chain 'F':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozf1, d3tozf2
  • Chain 'G':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozg1, d3tozg2
  • Chain 'H':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tozh1, d3tozh2
  • Heterogens: NAD, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tozA (A:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozA (A:)
    mtnkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvq
    gframnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymra
    lkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsk
    tdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvy
    kptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tozB (B:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozB (B:)
    tnkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqg
    framnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymral
    keaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinskt
    dckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvyk
    ptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tozC (C:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozC (C:)
    iteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfra
    mnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralkea
    ghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktdck
    aqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykptk
    trlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tozD (D:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozD (D:)
    nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
    ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralk
    eaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktd
    ckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykp
    tktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tozE (E:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozE (E:)
    nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
    ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralk
    eaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktd
    ckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykp
    tktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tozF (F:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozF (F:)
    iteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfra
    mnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralkea
    ghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktdck
    aqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykptk
    trlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3tozG (G:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozG (G:)
    mtnkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvq
    gframnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymra
    lkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsk
    tdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvy
    kptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3tozH (H:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tozH (H:)
    mtnkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvq
    gframnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymra
    lkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsk
    tdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvy
    kptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf