PDB entry 3toy

View 3toy on RCSB PDB site
Description: CRYSTAL STRUCTURE OF ENOLASE BRADO_4202 (TARGET EFI-501651) FROM Bradyrhizobium sp. ORS278 WITH CALCIUM AND ACETATE BOUND
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2011-09-06, released 2011-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3toya1, d3toya2
  • Chain 'B':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3toyb1, d3toyb2
  • Chain 'C':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3toyc1, d3toyc2
  • Chain 'D':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3toyd1, d3toyd2
  • Heterogens: CA, ACT, NI, P4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3toyA (A:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toyA (A:)
    ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
    lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
    pvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamik
    glrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerse
    ipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilp
    easahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3toyB (B:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toyB (B:)
    ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
    lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
    pvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamik
    glrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerse
    ipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilp
    easahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3toyC (C:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toyC (C:)
    ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
    lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
    pvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamik
    glrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerse
    ipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilp
    easahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3toyD (D:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toyD (D:)
    ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
    lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
    pvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamik
    glrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerse
    ipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilp
    easahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt